PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10000508m
Common NameCICLE_v10000508mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family TALE
Protein Properties Length: 674aa    MW: 74149.4 Da    PI: 6.1797
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10000508mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.37.3e-104284651954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +e+  LAk++gL+++qV +WF N R +
  Ciclev10000508m 428 FEHflHPYPNDSEKIMLAKQTGLSKNQVANWFINARVR 465
                      664459******************************88 PP

2BELL118.72.7e-38292363172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erqel +kk+kLls+leeVd+ Ykqy++q+q+v+ssF++vag+g+ak+Yt lAl++iSrhFr+L+dai++qi
  Ciclev10000508m 292 ERQELLNKKTKLLSMLEEVDRGYKQYYHQMQIVASSFDMVAGHGAAKSYTVLALQTISRHFRSLRDAISDQI 363
                      799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.1E-53217361IPR006563POX domain
PfamPF075262.3E-44223360IPR006563POX domain
PROSITE profilePS5007112.584406469IPR001356Homeobox domain
SMARTSM003896.7E-11409473IPR001356Homeobox domain
CDDcd000861.51E-13409470No hitNo description
SuperFamilySSF466891.2E-17410476IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-28412475IPR009057Homeodomain-like
PfamPF059201.7E-17426465IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MATYNPSLSY QRECFSTPVP GDNKFSNCLD PTSSHPDNVN MYVNPASSTE LYSEILSVGS  60
SLSPRNCVEV PSTGGTNGKM FIPSTSDAVV LPSIDGQLNA GTGNVILTTQ PSVLDGEQNF  120
QCQGLSLSLS TQMTSAVSVP SFQHQYSNPC FSSFLRTHLS VPGKGTMPCQ DNENETSKEL  180
RSSEGMLPGF QTEPPFNTQC SIGHNEMHSG TYQYEPIGFN STILKSKHLK AAQQLLDEAV  240
NIQKALKLPN SNKNDAKETD GRSSSMLPAF HGILSNPTES VSNSSSELSH AERQELLNKK  300
TKLLSMLEEV DRGYKQYYHQ MQIVASSFDM VAGHGAAKSY TVLALQTISR HFRSLRDAIS  360
DQIQVTGRSL GEQETSSNGQ ASIPRLRFVD HQSRQQRALQ QLGVMRHAWR PQRGLPESSV  420
SILRAWLFEH FLHPYPNDSE KIMLAKQTGL SKNQVANWFI NARVRLWKPM IEEMYKEEFG  480
DTEENSKSCL ENANKASSQN SSAPENRGEE LQDSLSSKSG RSIHDVMSDY VPDVEMNKPT  540
ASSLFQEGSH GDNVLNSGIM RLQNDQRPNI NDHRLYASIP HNQNGNDVLM GASAATYGMQ  600
ELRGYAISNQ VSLALGLRHQ GTDVFPVSAG NNIGGDKIVV SSEGHDTADY HCMDLGNQQD  660
RFGNPQLLHD FVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-16415472158Homeobox protein Meis1
4xrs_A3e-16415472158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435065.10.0hypothetical protein CICLE_v10000508mg
SwissprotQ9FWS91e-121BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLV4T9Y10.0V4T9Y1_9R
STRINGPOPTR_0002s03240.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-117BEL1-like homeodomain 3